![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily) core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet |
![]() | Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) ![]() |
![]() | Family d.116.1.0: automated matches [191417] (1 protein) not a true family |
![]() | Protein automated matches [190578] (4 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [188266] (3 PDB entries) |
![]() | Domain d3rijc_: 3rij C: [184988] automated match to d1wdva_ complexed with gol |
PDB Entry: 3rij (more details), 2.3 Å
SCOPe Domain Sequences for d3rijc_:
Sequence, based on SEQRES records: (download)
>d3rijc_ d.116.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvyggekgay lflvsgknrldlgkatrlvggplleadkwavaaltgfdaggvppvghntplpayldedll gypevwaaggtpralfratpkellaltgaqvadlkeg
>d3rijc_ d.116.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} slspsarrvqgaletrgfghlkvvelpeaaqavgaevgqivkslvyggekgaylflvsgk nrldlgkatrlvggplleadkwavaaltgfdaggvppvghntplpayldedllgypevwa aggtpralfratpkellaltgaqvadlkeg
Timeline for d3rijc_: