Lineage for d3rijc_ (3rij C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972065Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet
  4. 2972066Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) (S)
  5. 2972087Family d.116.1.0: automated matches [191417] (1 protein)
    not a true family
  6. 2972088Protein automated matches [190578] (4 species)
    not a true protein
  7. 2972094Species Thermus thermophilus HB8 [TaxId:300852] [188266] (3 PDB entries)
  8. 2972100Domain d3rijc_: 3rij C: [184988]
    automated match to d1wdva_
    complexed with gol

Details for d3rijc_

PDB Entry: 3rij (more details), 2.3 Å

PDB Description: epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins
PDB Compounds: (C:) SC_2cx5

SCOPe Domain Sequences for d3rijc_:

Sequence, based on SEQRES records: (download)

>d3rijc_ d.116.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvyggekgay
lflvsgknrldlgkatrlvggplleadkwavaaltgfdaggvppvghntplpayldedll
gypevwaaggtpralfratpkellaltgaqvadlkeg

Sequence, based on observed residues (ATOM records): (download)

>d3rijc_ d.116.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
slspsarrvqgaletrgfghlkvvelpeaaqavgaevgqivkslvyggekgaylflvsgk
nrldlgkatrlvggplleadkwavaaltgfdaggvppvghntplpayldedllgypevwa
aggtpralfratpkellaltgaqvadlkeg

SCOPe Domain Coordinates for d3rijc_:

Click to download the PDB-style file with coordinates for d3rijc_.
(The format of our PDB-style files is described here.)

Timeline for d3rijc_: