Lineage for d3ri9a_ (3ri9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780101Species Aspergillus kawachii [TaxId:40384] [49988] (4 PDB entries)
    Uniprot P55328 29-210 # 100% sequence identity; Aspergillus awamori TaxID: 105351
  8. 2780104Domain d3ri9a_: 3ri9 A: [184981]
    automated match to d1bk1a_
    mutant

Details for d3ri9a_

PDB Entry: 3ri9 (more details), 2 Å

PDB Description: Xylanase C from Aspergillus kawachii F131W mutant
PDB Compounds: (A:) Endo-1,4-beta-xylanase 3

SCOPe Domain Sequences for d3ri9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ri9a_ b.29.1.11 (A:) Xylanase II {Aspergillus kawachii [TaxId: 40384]}
aginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysas
gsssylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsi
tgtstftqywsvrestrtsgtvtvanhfnfwaqhgfgnsdfnyqvmaveawsgagsasvt
is

SCOPe Domain Coordinates for d3ri9a_:

Click to download the PDB-style file with coordinates for d3ri9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ri9a_: