Lineage for d1nola2 (1nol A:110-379)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002034Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2002035Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2002036Family a.86.1.1: Hemocyanin middle domain [48057] (2 protein domains)
  6. 2002037Protein Arthropod hemocyanin [48058] (2 species)
    N-terminal domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 2002038Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48059] (4 PDB entries)
  8. 2002041Domain d1nola2: 1nol A:110-379 [18498]
    Other proteins in same PDB: d1nola1, d1nola3
    complexed with ca, cu, no3, per

Details for d1nola2

PDB Entry: 1nol (more details), 2.4 Å

PDB Description: oxygenated hemocyanin (subunit type ii)
PDB Compounds: (A:) hemocyanin (subunit type II)

SCOPe Domain Sequences for d1nola2:

Sequence, based on SEQRES records: (download)

>d1nola2 a.86.1.1 (A:110-379) Arthropod hemocyanin {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pvqeifpdkfipsaaineafkkahvrpefdespilvdvqdtgnildpeyrlayyredvgi
nahhwhwhlvypstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnf
deplagyaphlthvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvised
gshktldelhgtdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvms
dtstslrdpifynwhrfidnifheykntlk

Sequence, based on observed residues (ATOM records): (download)

>d1nola2 a.86.1.1 (A:110-379) Arthropod hemocyanin {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
pvqeifpdkfipsaaineafkkahdespilvdvqdtgnildpeyrlayyredvginahhw
hwhlvypstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdepla
gyaphlthvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshkt
ldelhgtdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtsts
lrdpifynwhrfidnifheykntlk

SCOPe Domain Coordinates for d1nola2:

Click to download the PDB-style file with coordinates for d1nola2.
(The format of our PDB-style files is described here.)

Timeline for d1nola2: