Lineage for d3ri3b_ (3ri3 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1576689Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1577849Protein automated matches [190085] (43 species)
    not a true protein
  7. 1578178Species Streptomyces coelicolor [TaxId:1902] [189970] (5 PDB entries)
  8. 1578180Domain d3ri3b_: 3ri3 B: [184979]
    automated match to d1w4zb_
    complexed with emo, ndp; mutant

Details for d3ri3b_

PDB Entry: 3ri3 (more details), 2.29 Å

PDB Description: actinorhodin polyketide ketoreductase mutant p94l bound to nadph and the inhibitor emodin
PDB Compounds: (B:) ketoacyl reductase

SCOPe Domain Sequences for d3ri3b_:

Sequence, based on SEQRES records: (download)

>d3ri3b_ c.2.1.2 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
rgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagve
adgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnlt
gvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglela
rtgitvnavcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemv
ayligpgaaavtaqalnvcgglgny

Sequence, based on observed residues (ATOM records): (download)

>d3ri3b_ c.2.1.2 (B:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
rgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagve
adgrtcdvrsvpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnlt
gvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglela
rtgitvnavcpgfvetpmaasvrehteeafdritarvpigryvqpsevaemvayligpga
aavtaqalnvcgglgny

SCOPe Domain Coordinates for d3ri3b_:

Click to download the PDB-style file with coordinates for d3ri3b_.
(The format of our PDB-style files is described here.)

Timeline for d3ri3b_: