Lineage for d3rhya_ (3rhy A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213833Family d.126.1.3: Dimethylarginine dimethylaminohydrolase DDAH [64380] (1 protein)
    functionally related to the amidinotransferase, similar active sites
    automatically mapped to Pfam PF02274
  6. 2213834Protein Dimethylarginine dimethylaminohydrolase DDAH [64381] (1 species)
  7. 2213835Species Pseudomonas aeruginosa [TaxId:287] [64382] (3 PDB entries)
  8. 2213837Domain d3rhya_: 3rhy A: [184972]
    automated match to d1h70a_
    complexed with hm3

Details for d3rhya_

PDB Entry: 3rhy (more details), 2.18 Å

PDB Description: Crystal structure of the dimethylarginine dimethylaminohydrolase adduct with 4-chloro-2-hydroxymethylpyridine
PDB Compounds: (A:) N(G),N(G)-dimethylarginine dimethylaminohydrolase

SCOPe Domain Sequences for d3rhya_:

Sequence, based on SEQRES records: (download)

>d3rhya_ d.126.1.3 (A:) Dimethylarginine dimethylaminohydrolase DDAH {Pseudomonas aeruginosa [TaxId: 287]}
mfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfpd
svfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimm
vgdhfyigesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaage
fvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtsey
rkidggvscmslrf

Sequence, based on observed residues (ATOM records): (download)

>d3rhya_ d.126.1.3 (A:) Dimethylarginine dimethylaminohydrolase DDAH {Pseudomonas aeruginosa [TaxId: 287]}
mfkhiiartparslvdlgkpdyakaleqhnayiralqtcdvditllppderfpdsvfved
pvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimmvgdhfy
igesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaagefvskpe
fqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtseyrkidgg
vscmslrf

SCOPe Domain Coordinates for d3rhya_:

Click to download the PDB-style file with coordinates for d3rhya_.
(The format of our PDB-style files is described here.)

Timeline for d3rhya_: