SCOPe 2.06: Domain d3rhub_: 3rhu B:

Lineage for d3rhub_ (3rhu B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families)
   putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)

5. Family d.67.1.2: AlaX-like [103051] (3 proteins)

6. Protein automated matches [191255] (1 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [189797] (2 PDB entries)

8. Domain d3rhub_: 3rhu B: [184969]
   automated match to d1v4pa_

Details for d3rhub_

PDB Entry: 3rhu, 2.8 Å

PDB Description: epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins

PDB Compounds: (B:) SC_1wnu

SCOPe Domain Sequences for d3rhub_:

Sequence, based on SEQRES records:

>d3rhub_ d.67.1.2 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
ysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaieal
anekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeht
kttgeigpikirkvrfrkskglleihfell

Sequence, based on observed residues (ATOM records):

>d3rhub_ d.67.1.2 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
ysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaieal
anekvkenapikiyelpreeaekmfgedmydilkvvviedwnvnacnkehtkttgeigpi
kirkvrfrkskglleihfell

Timeline for d3rhub_:

• d3rhub_ first appeared in SCOPe 2.01
  
• d3rhub_ appears in SCOPe 2.05
  
• d3rhub_ appears in SCOPe 2.07
  
• d3rhub_ appears in the current release, SCOPe 2.08