Lineage for d3rhub_ (3rhu B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956973Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2956974Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 2956988Family d.67.1.2: AlaX-like [103051] (3 proteins)
  6. 2957004Protein automated matches [191255] (1 species)
    not a true protein
  7. 2957005Species Pyrococcus horikoshii OT3 [TaxId:70601] [189797] (2 PDB entries)
  8. 2957008Domain d3rhub_: 3rhu B: [184969]
    automated match to d1v4pa_

Details for d3rhub_

PDB Entry: 3rhu (more details), 2.8 Å

PDB Description: epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins
PDB Compounds: (B:) SC_1wnu

SCOPe Domain Sequences for d3rhub_:

Sequence, based on SEQRES records: (download)

>d3rhub_ d.67.1.2 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
ysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaieal
anekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeht
kttgeigpikirkvrfrkskglleihfell

Sequence, based on observed residues (ATOM records): (download)

>d3rhub_ d.67.1.2 (B:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
ysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaieal
anekvkenapikiyelpreeaekmfgedmydilkvvviedwnvnacnkehtkttgeigpi
kirkvrfrkskglleihfell

SCOPe Domain Coordinates for d3rhub_:

Click to download the PDB-style file with coordinates for d3rhub_.
(The format of our PDB-style files is described here.)

Timeline for d3rhub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3rhua_