![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) ![]() putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2) |
![]() | Family d.67.1.2: AlaX-like [103051] (3 proteins) |
![]() | Protein automated matches [191255] (1 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [189797] (2 PDB entries) |
![]() | Domain d3rhua_: 3rhu A: [184968] automated match to d1v4pa_ |
PDB Entry: 3rhu (more details), 2.8 Å
SCOPe Domain Sequences for d3rhua_:
Sequence, based on SEQRES records: (download)
>d3rhua_ d.67.1.2 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} ysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaieal anekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeht kttgeigpikirkvrfrkskglleihfell
>d3rhua_ d.67.1.2 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} ysievrthsalhvvkgavvktagsdakwttstyvkgnkgvlivkaalepdkwgiaaieal anekvkenapikiyelpreeaekmfgedmydilkvvviedwnvnacnkehtkttgeigpi kirkvrfrkskglleihfell
Timeline for d3rhua_: