Class a: All alpha proteins [46456] (284 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) dimer of identical subunits |
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins) automatically mapped to Pfam PF00216 |
Protein automated matches [190320] (2 species) not a true protein |
Species Bacillus anthracis [TaxId:260799] [189933] (1 PDB entry) |
Domain d3rhid_: 3rhi D: [184967] automated match to d1huea_ |
PDB Entry: 3rhi (more details), 2.48 Å
SCOPe Domain Sequences for d3rhid_:
Sequence, based on SEQRES records: (download)
>d3rhid_ a.55.1.1 (D:) automated matches {Bacillus anthracis [TaxId: 260799]} mnkteliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartg rnpqtgeemqiaaskvpafkagkelkeavk
>d3rhid_ a.55.1.1 (D:) automated matches {Bacillus anthracis [TaxId: 260799]} mnkteliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraarte mqiaaskvpafkagkelkeavk
Timeline for d3rhid_: