Lineage for d3rhid_ (3rhi D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715143Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2715189Protein automated matches [190320] (2 species)
    not a true protein
  7. 2715190Species Bacillus anthracis [TaxId:260799] [189933] (1 PDB entry)
  8. 2715194Domain d3rhid_: 3rhi D: [184967]
    Other proteins in same PDB: d3rhib2
    automated match to d1huea_

Details for d3rhid_

PDB Entry: 3rhi (more details), 2.48 Å

PDB Description: dna-binding protein hu from bacillus anthracis
PDB Compounds: (D:) DNA-binding protein HU

SCOPe Domain Sequences for d3rhid_:

Sequence, based on SEQRES records: (download)

>d3rhid_ a.55.1.1 (D:) automated matches {Bacillus anthracis [TaxId: 260799]}
mnkteliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartg
rnpqtgeemqiaaskvpafkagkelkeavk

Sequence, based on observed residues (ATOM records): (download)

>d3rhid_ a.55.1.1 (D:) automated matches {Bacillus anthracis [TaxId: 260799]}
mnkteliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraarte
mqiaaskvpafkagkelkeavk

SCOPe Domain Coordinates for d3rhid_:

Click to download the PDB-style file with coordinates for d3rhid_.
(The format of our PDB-style files is described here.)

Timeline for d3rhid_: