Lineage for d3rhic_ (3rhi C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328278Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2328279Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2328280Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2328326Protein automated matches [190320] (2 species)
    not a true protein
  7. 2328327Species Bacillus anthracis [TaxId:260799] [189933] (1 PDB entry)
  8. 2328330Domain d3rhic_: 3rhi C: [184966]
    Other proteins in same PDB: d3rhib2
    automated match to d1huea_

Details for d3rhic_

PDB Entry: 3rhi (more details), 2.48 Å

PDB Description: dna-binding protein hu from bacillus anthracis
PDB Compounds: (C:) DNA-binding protein HU

SCOPe Domain Sequences for d3rhic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rhic_ a.55.1.1 (C:) automated matches {Bacillus anthracis [TaxId: 260799]}
mnkteliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartg
rnpqtgeemqiaaskvpafkagkelkeavk

SCOPe Domain Coordinates for d3rhic_:

Click to download the PDB-style file with coordinates for d3rhic_.
(The format of our PDB-style files is described here.)

Timeline for d3rhic_: