SCOPe 2.06: Domain d3rhib1: 3rhi B:1-90

Lineage for d3rhib1 (3rhi B:1-90)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein automated matches [190320] (2 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:260799] [189933] (1 PDB entry)

8. Domain d3rhib1: 3rhi B:1-90 [184965]
   Other proteins in same PDB: d3rhib2
   automated match to d1huea_

Details for d3rhib1

PDB Entry: 3rhi, 2.48 Å

PDB Description: dna-binding protein hu from bacillus anthracis

PDB Compounds: (B:) DNA-binding protein HU

SCOPe Domain Sequences for d3rhib1:

Sequence, based on SEQRES records:

>d3rhib1 a.55.1.1 (B:1-90) automated matches {Bacillus anthracis [TaxId: 260799]}
mnkteliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartg
rnpqtgeemqiaaskvpafkagkelkeavk

Sequence, based on observed residues (ATOM records):

>d3rhib1 a.55.1.1 (B:1-90) automated matches {Bacillus anthracis [TaxId: 260799]}
mnkteliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartg
qtgeemqiaaskvpafkagkelkeavk

Timeline for d3rhib1:

• d3rhib1 first appeared in SCOPe 2.01, called d3rhib_
  
• d3rhib1 was called d3rhib_ in SCOPe 2.05
  
• d3rhib1 appears in SCOPe 2.07
  
• d3rhib1 appears in the current release, SCOPe 2.08