SCOPe 2.03: Domain d3rhia_: 3rhi A:

Lineage for d3rhia_ (3rhi A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein automated matches [190320] (2 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:260799] [189933] (1 PDB entry)

8. Domain d3rhia_: 3rhi A: [184964]
   automated match to d1huea_

Details for d3rhia_

PDB Entry: 3rhi, 2.48 Å

PDB Description: dna-binding protein hu from bacillus anthracis

PDB Compounds: (A:) DNA-binding protein HU

SCOPe Domain Sequences for d3rhia_:

Sequence; same for both SEQRES and ATOM records:

>d3rhia_ a.55.1.1 (A:) automated matches {Bacillus anthracis [TaxId: 260799]}
teliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartgrnp
qtgeemqiaaskvpafkagkelkeavk

Timeline for d3rhia_:

• d3rhia_ first appeared in SCOPe 2.01
  
• d3rhia_ appears in SCOPe 2.02
  
• d3rhia_ appears in SCOPe 2.04
  
• d3rhia_ appears in the current release, SCOPe 2.08