Lineage for d3rhia_ (3rhi A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916627Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 916628Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 916629Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
  6. 916674Protein automated matches [190320] (2 species)
    not a true protein
  7. 916675Species Bacillus anthracis [TaxId:260799] [189933] (1 PDB entry)
  8. 916676Domain d3rhia_: 3rhi A: [184964]
    automated match to d1huea_

Details for d3rhia_

PDB Entry: 3rhi (more details), 2.48 Å

PDB Description: dna-binding protein hu from bacillus anthracis
PDB Compounds: (A:) DNA-binding protein HU

SCOPe Domain Sequences for d3rhia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rhia_ a.55.1.1 (A:) automated matches {Bacillus anthracis [TaxId: 260799]}
teliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartgrnp
qtgeemqiaaskvpafkagkelkeavk

SCOPe Domain Coordinates for d3rhia_:

Click to download the PDB-style file with coordinates for d3rhia_.
(The format of our PDB-style files is described here.)

Timeline for d3rhia_: