![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
![]() | Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
![]() | Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins) |
![]() | Protein automated matches [190320] (2 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:260799] [189933] (1 PDB entry) |
![]() | Domain d3rhia_: 3rhi A: [184964] automated match to d1huea_ |
PDB Entry: 3rhi (more details), 2.48 Å
SCOPe Domain Sequences for d3rhia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rhia_ a.55.1.1 (A:) automated matches {Bacillus anthracis [TaxId: 260799]} teliknvaqnaeisqkeatvvvqtvvesitntlaagekvqligfgtfevreraartgrnp qtgeemqiaaskvpafkagkelkeavk
Timeline for d3rhia_: