SCOPe 2.06: Domain d3rgvd1: 3rgv D:1-99

Lineage for d3rgvd1 (3rgv D:1-99)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein beta2-microglobulin [88600] (6 species)
Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
Uniprot P01887
Domain d3rgvd1: 3rgv D:1-99 [184963]
Other proteins in same PDB: d3rgva1, d3rgva2, d3rgvb1, d3rgvb2, d3rgvc1, d3rgvc2, d3rgvd2
automated match to d1biib_

Details for d3rgvd1

PDB Entry: 3rgv (more details), 2.9 Å

PDB Description: A single TCR bound to MHCI and MHC II reveals switchable TCR conformers

PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d3rgvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgvd1 b.1.1.2 (D:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d3rgvd1:

Click to download the PDB-style file with coordinates for d3rgvd1.
(The format of our PDB-style files is described here.)

Timeline for d3rgvd1: