Lineage for d3rgna_ (3rgn A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627626Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2627820Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 2627837Protein Outer membrane cobalamin transporter BtuB [90129] (1 species)
    vitamin B12 receptor
  7. 2627838Species Escherichia coli [TaxId:562] [90130] (12 PDB entries)
  8. 2627842Domain d3rgna_: 3rgn A: [184954]
    automated match to d1ujwa_
    complexed with c8e, mg, mtn

Details for d3rgna_

PDB Entry: 3rgn (more details), 2.3 Å

PDB Description: crystal structure of spin-labeled btub w371r1
PDB Compounds: (A:) Vitamin B12 transporter btuB

SCOPe Domain Sequences for d3rgna_:

Sequence, based on SEQRES records: (download)

>d3rgna_ f.4.3.3 (A:) Outer membrane cobalamin transporter BtuB {Escherichia coli [TaxId: 562]}
dtlvvtanrfeqprstvlapttvvtrqdidrwqstsvndvlrrlpgvditqnggsgqlss
ifirgtnashvlvlidgvrlnlagvsgsadlsqfpialvqrveyirgprsavygsdaigg
vvniittrdepgteisagwgsnsyqnydvstqqqlgdktrvtllgdyahthgydvvaygn
tgtqaqtdndgflsktlygalehnftdawsgfvrgygydnrtnydayyspgsplldtrkl
ysqswdaglryngeliksqlitsyshskdynydphygrydssatldemkqytvqwannvi
vghgsigagvdwqkqtttpgtgyvedgydqrntgiyltglqqvgdftfegaarsddnsqf
grhgtcqtsagwefiegyrfiasygtsykapnlgqlygfygnpnldpekskqwegafegl
tagvnwrisgyrndvsdlidyddhtlkyynegkarikgveatanfdtgplthtvsydyvd
arnaitdtpllrrakqqvkyqldwqlydfdwgityqylgtrydkdyssypyqtvkmggvs
lwdlavaypvtshltvrgkianlfdkdyetvygyqtagreytlsgsytf

Sequence, based on observed residues (ATOM records): (download)

>d3rgna_ f.4.3.3 (A:) Outer membrane cobalamin transporter BtuB {Escherichia coli [TaxId: 562]}
dtlvvtanrfeqprstvlapttvvtrqdidrwqstsvndvlrrlpgvditqnggsgqlss
ifirgtnashvlvlidgvrlnlagvsgsadlsqfpialvqrveyirgprsavygsdaigg
vvniittrdepgteisagwgsnsyqnydvstqqqlgdktrvtllgdyahthggflsktly
galehnftdawsgfvrgygydnrtntrklysqswdaglryngeliksqlitsyshskdyn
ysatldemkqytvqwannvivghgsigagvdwqkqtttpgtgyvedgydqrntgiyltgl
qqvgdftfegaarsddnsqfgrhgtcqtsagwefiegyrfiasygtsykapnlgqlygfy
gnpnldpekskqwegafegltagvnwrisgyrndvsdlidyddhtlkyynegkarikgve
atanfdtgplthtvsydyvdarnaitdtpllrrakqqvkyqldwqlydfdwgityqylgt
rydkdyssypyqtvkmggvslwdlavaypvtshltvrgkianlfdkdyetvygyqtagre
ytlsgsytf

SCOPe Domain Coordinates for d3rgna_:

Click to download the PDB-style file with coordinates for d3rgna_.
(The format of our PDB-style files is described here.)

Timeline for d3rgna_: