Lineage for d3rgka_ (3rgk A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2687970Species Human (Homo sapiens) [TaxId:9606] [46475] (1 PDB entry)
  8. 2687971Domain d3rgka_: 3rgk A: [184952]
    automated match to d2mm1a_
    complexed with hem, so4; mutant

Details for d3rgka_

PDB Entry: 3rgk (more details), 1.65 Å

PDB Description: Crystal Structure of Human Myoglobin Mutant K45R
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3rgka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgka_ a.1.1.2 (A:) Myoglobin {Human (Homo sapiens) [TaxId: 9606]}
glsdgewqlvlnvwgkveadipghgqevlirlfkghpetlekfdrfkhlksedemkased
lkkhgatvltalggilkkkghheaeikplaqshatkhkipvkylefiseaiiqvlqskhp
gdfgadaqgamnkalelfrkdmasnykel

SCOPe Domain Coordinates for d3rgka_:

Click to download the PDB-style file with coordinates for d3rgka_.
(The format of our PDB-style files is described here.)

Timeline for d3rgka_: