SCOP 1.63: Domain d1hcy_1: 1hcy 1-135

Lineage for d1hcy_1 (1hcy 1-135)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
   6 helices; bundle; one central helix is surrounded by 5 others

4. Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family)

5. Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)

6. Protein Hemocyanin, N-terminal domain [48052] (2 species)
   Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich

7. Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (7 PDB entries)

8. Domain d1hcy_1: 1hcy 1-135 [18495]
   Other proteins in same PDB: d1hcy_2, d1hcy_3
   complexed with cu, nag

Details for d1hcy_1

PDB Entry: 1hcy, 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hcy_1:

Sequence; same for both SEQRES and ATOM records:

>d1hcy_1 a.85.1.1 (1-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus)}
dalgtgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkel
ndhrlleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyaly
vsvihsklgdgivlp

Timeline for d1hcy_1:

• d1hcy_1 first appeared (with stable ids) in SCOP 1.55
  
• d1hcy_1 appears in SCOP 1.61
  
• d1hcy_1 appears in SCOP 1.65
  
• d1hcy_1 appears in the current release, SCOPe 2.08, called d1hcya1