| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) ![]() |
| Family c.23.8.0: automated matches [191522] (1 protein) not a true family |
| Protein automated matches [190879] (8 species) not a true protein |
| Species Treponema denticola [TaxId:158] [189960] (2 PDB entries) |
| Domain d3rg8g_: 3rg8 G: [184944] automated match to d1o4va_ complexed with edo |
PDB Entry: 3rg8 (more details), 1.74 Å
SCOPe Domain Sequences for d3rg8g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rg8g_ c.23.8.0 (G:) automated matches {Treponema denticola [TaxId: 158]}
mrplviilmgsssdmghaekiaselktfgieyairigsahktaehvvsmlkeyealdrpk
lyitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepkna
allaarifslydkeiadsvksymesnaqkiieddsklkr
Timeline for d3rg8g_: