Lineage for d3rg8f_ (3rg8 F:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 983179Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 983253Family c.23.8.0: automated matches [191522] (1 protein)
    not a true family
  6. 983254Protein automated matches [190879] (3 species)
    not a true protein
  7. 983262Species Treponema denticola [TaxId:158] [189960] (2 PDB entries)
  8. 983268Domain d3rg8f_: 3rg8 F: [184943]
    automated match to d1o4va_
    complexed with edo

Details for d3rg8f_

PDB Entry: 3rg8 (more details), 1.74 Å

PDB Description: Crystal structure of Treponema denticola PurE
PDB Compounds: (F:) Phosphoribosylaminoimidazole carboxylase, PurE protein

SCOPe Domain Sequences for d3rg8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rg8f_ c.23.8.0 (F:) automated matches {Treponema denticola [TaxId: 158]}
rplviilmgsssdmghaekiaselktfgieyairigsahktaehvvsmlkeyealdrpkl
yitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepknaa
llaarifslydkeiadsvksymesnaqkiieddskl

SCOPe Domain Coordinates for d3rg8f_:

Click to download the PDB-style file with coordinates for d3rg8f_.
(The format of our PDB-style files is described here.)

Timeline for d3rg8f_: