SCOPe 2.06: Domain d1hc1a1: 1hc1 A:5-135

Lineage for d1hc1a1 (1hc1 A:5-135)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
   6 helices; bundle; one central helix is surrounded by 5 others

4. Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family)
   automatically mapped to Pfam PF03722

5. Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)

6. Protein Hemocyanin, N-terminal domain [48052] (2 species)
   Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich

7. Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (2 PDB entries)

8. Domain d1hc1a1: 1hc1 A:5-135 [18494]
   Other proteins in same PDB: d1hc1a2, d1hc1a3
   complexed with cu

Details for d1hc1a1

PDB Entry: 1hc1, 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

PDB Compounds: (A:) arthropodan hemocyanin

SCOPe Domain Sequences for d1hc1a1:

Sequence; same for both SEQRES and ATOM records:

>d1hc1a1 a.85.1.1 (A:5-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]}
tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr
lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi
hsklgdgivlp

Timeline for d1hc1a1:

• d1hc1a1 first appeared (with stable ids) in SCOP 1.55, called d1hc1_1
  
• d1hc1a1 appears in SCOPe 2.05
  
• d1hc1a1 appears in SCOPe 2.07
  
• d1hc1a1 appears in the current release, SCOPe 2.08