![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily) 6 helices; bundle; one central helix is surrounded by 5 others |
![]() | Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) ![]() automatically mapped to Pfam PF03722 |
![]() | Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein) |
![]() | Protein Hemocyanin, N-terminal domain [48052] (2 species) Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich |
![]() | Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (2 PDB entries) |
![]() | Domain d1hc1a1: 1hc1 A:5-135 [18494] Other proteins in same PDB: d1hc1a2, d1hc1a3 complexed with cu |
PDB Entry: 1hc1 (more details), 3.2 Å
SCOPe Domain Sequences for d1hc1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hc1a1 a.85.1.1 (A:5-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus) [TaxId: 6735]} tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi hsklgdgivlp
Timeline for d1hc1a1: