Lineage for d3rfna_ (3rfn A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563701Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2563702Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 2563716Family d.67.1.2: AlaX-like [103051] (3 proteins)
  6. 2563732Protein automated matches [191255] (1 species)
    not a true protein
  7. 2563733Species Pyrococcus horikoshii OT3 [TaxId:70601] [189797] (2 PDB entries)
  8. 2563734Domain d3rfna_: 3rfn A: [184937]
    automated match to d1v4pa_
    complexed with zn

Details for d3rfna_

PDB Entry: 3rfn (more details), 1.8 Å

PDB Description: epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins
PDB Compounds: (A:) BB_1wnu_001

SCOPe Domain Sequences for d3rfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rfna_ d.67.1.2 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
ysievrthsalhvvkgavvkaagsaakwttstyvkgnkgvlivkaaleldkwawaameal
anekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeht
kttgeigpikirkvrfrkskglleihfelle

SCOPe Domain Coordinates for d3rfna_:

Click to download the PDB-style file with coordinates for d3rfna_.
(The format of our PDB-style files is described here.)

Timeline for d3rfna_: