SCOPe 2.03: Domain d3rfna_: 3rfn A:

Lineage for d3rfna_ (3rfn A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families)
   putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)

5. Family d.67.1.2: AlaX-like [103051] (3 proteins)

6. Protein automated matches [191255] (1 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [189797] (2 PDB entries)

8. Domain d3rfna_: 3rfn A: [184937]
   automated match to d1v4pa_
   complexed with zn

Details for d3rfna_

PDB Entry: 3rfn, 1.8 Å

PDB Description: epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins

PDB Compounds: (A:) BB_1wnu_001

SCOPe Domain Sequences for d3rfna_:

Sequence; same for both SEQRES and ATOM records:

>d3rfna_ d.67.1.2 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
ysievrthsalhvvkgavvkaagsaakwttstyvkgnkgvlivkaaleldkwawaameal
anekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeht
kttgeigpikirkvrfrkskglleihfelle

Timeline for d3rfna_:

• d3rfna_ first appeared in SCOPe 2.01
  
• d3rfna_ appears in SCOPe 2.02
  
• d3rfna_ appears in SCOPe 2.04
  
• d3rfna_ appears in the current release, SCOPe 2.08