![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
![]() | Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
![]() | Protein automated matches [190903] (8 species) not a true protein |
![]() | Species Ancylostoma ceylanicum [TaxId:53326] [188849] (3 PDB entries) |
![]() | Domain d3rf5c_: 3rf5 C: [184936] automated match to d1mffa_ complexed with act, fuz, imd, zn |
PDB Entry: 3rf5 (more details), 2.1 Å
SCOPe Domain Sequences for d3rf5c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rf5c_ d.80.1.0 (C:) automated matches {Ancylostoma ceylanicum [TaxId: 53326]} pmvrvatnlpdkdvpanfeerltdllaesmnkprnriaievlagqrithgasrnpvavik vesigalsaddnirhtqkitqfcqdtlklpkdkviityfdlqpihvgfngttvaaa
Timeline for d3rf5c_: