Lineage for d3rf5c_ (3rf5 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961447Species Ancylostoma ceylanicum [TaxId:53326] [188849] (3 PDB entries)
  8. 2961457Domain d3rf5c_: 3rf5 C: [184936]
    automated match to d1mffa_
    complexed with act, fuz, imd, zn

Details for d3rf5c_

PDB Entry: 3rf5 (more details), 2.1 Å

PDB Description: Ancylostoma ceylanicum mif in complex with n-(2,3,4,5,6-pentafluoro-benzyl)-4-sulfamoyl-benzamide
PDB Compounds: (C:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d3rf5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rf5c_ d.80.1.0 (C:) automated matches {Ancylostoma ceylanicum [TaxId: 53326]}
pmvrvatnlpdkdvpanfeerltdllaesmnkprnriaievlagqrithgasrnpvavik
vesigalsaddnirhtqkitqfcqdtlklpkdkviityfdlqpihvgfngttvaaa

SCOPe Domain Coordinates for d3rf5c_:

Click to download the PDB-style file with coordinates for d3rf5c_.
(The format of our PDB-style files is described here.)

Timeline for d3rf5c_: