| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
| Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
| Protein automated matches [190903] (22 species) not a true protein |
| Species Ancylostoma ceylanicum [TaxId:53326] [188849] (3 PDB entries) |
| Domain d3rf4a_: 3rf4 A: [184931] automated match to d1mffa_ complexed with act, fun, imd, zn |
PDB Entry: 3rf4 (more details), 1.8 Å
SCOPe Domain Sequences for d3rf4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rf4a_ d.80.1.0 (A:) automated matches {Ancylostoma ceylanicum [TaxId: 53326]}
pmvrvatnlpdkdvpanfeerltdllaesmnkprnriaievlagqrithgasrnpvavik
vesigalsaddnirhtqkitqfcqdtlklpkdkviityfdlqpihvgfngttvaaa
Timeline for d3rf4a_: