| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) ![]() |
| Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins) intertwined homodimer of 3-helical subunits |
| Protein automated matches [191058] (1 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries) |
| Domain d3retb_: 3ret B: [184928] automated match to d2h9ca1 complexed with pyr, sal; mutant |
PDB Entry: 3ret (more details), 1.79 Å
SCOPe Domain Sequences for d3retb_:
Sequence, based on SEQRES records: (download)
>d3retb_ a.130.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfeaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikywrqt
>d3retb_ a.130.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfipapervaamlperarwae
engldapfveglfaqiihwyiaeqikywrqt
Timeline for d3retb_: