Lineage for d3retb_ (3ret B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098826Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 1098827Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 1098828Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 1098848Protein automated matches [191058] (1 species)
    not a true protein
  7. 1098849Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)
  8. 1098851Domain d3retb_: 3ret B: [184928]
    automated match to d2h9ca1
    complexed with pyr, sal; mutant

Details for d3retb_

PDB Entry: 3ret (more details), 1.79 Å

PDB Description: Salicylate and Pyruvate Bound Structure of the Isochorismate-Pyruvate Lyase K42E Mutant from Pseudomonas aerugionsa
PDB Compounds: (B:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3retb_:

Sequence, based on SEQRES records: (download)

>d3retb_ a.130.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfeaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikywrqt

Sequence, based on observed residues (ATOM records): (download)

>d3retb_ a.130.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfipapervaamlperarwae
engldapfveglfaqiihwyiaeqikywrqt

SCOPe Domain Coordinates for d3retb_:

Click to download the PDB-style file with coordinates for d3retb_.
(The format of our PDB-style files is described here.)

Timeline for d3retb_: