Lineage for d3reta_ (3ret A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732500Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 2732520Protein automated matches [191058] (2 species)
    not a true protein
  7. 2732524Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)
  8. 2732525Domain d3reta_: 3ret A: [184927]
    automated match to d2h9ca1
    complexed with pyr, sal; mutant

Details for d3reta_

PDB Entry: 3ret (more details), 1.79 Å

PDB Description: Salicylate and Pyruvate Bound Structure of the Isochorismate-Pyruvate Lyase K42E Mutant from Pseudomonas aerugionsa
PDB Compounds: (A:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3reta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3reta_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfeaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikywrqt

SCOPe Domain Coordinates for d3reta_:

Click to download the PDB-style file with coordinates for d3reta_.
(The format of our PDB-style files is described here.)

Timeline for d3reta_: