SCOPe 2.08: Domain d3reta_: 3ret A:

Lineage for d3reta_ (3ret A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein automated matches [191058] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)

8. Domain d3reta_: 3ret A: [184927]
   automated match to d2h9ca1
   complexed with pyr, sal; mutant

Details for d3reta_

PDB Entry: 3ret, 1.79 Å

PDB Description: Salicylate and Pyruvate Bound Structure of the Isochorismate-Pyruvate Lyase K42E Mutant from Pseudomonas aerugionsa

PDB Compounds: (A:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3reta_:

Sequence; same for both SEQRES and ATOM records:

>d3reta_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfeaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikywrqt

Timeline for d3reta_:

• d3reta_ first appeared in SCOPe 2.01
  
• d3reta_ appears in SCOPe 2.07