SCOPe 2.01: Domain d3remb_: 3rem B:

Lineage for d3remb_ (3rem B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (4 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein automated matches [191058] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)

8. Domain d3remb_: 3rem B: [184907]
   automated match to d2h9ca1
   complexed with pyr, sal

Details for d3remb_

PDB Entry: 3rem, 1.95 Å

PDB Description: Structure of the Isochorismate-Pyruvate Lyase from Pseudomonas aerugionsa with Bound Salicylate and Pyruvate

PDB Compounds: (B:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3remb_:

Sequence; same for both SEQRES and ATOM records:

>d3remb_ a.130.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlper
arwaeengldapfveglfaqiihwyiaeqikywrqtr

Timeline for d3remb_:

• d3remb_ is new in SCOPe 2.01-stable
  
• d3remb_ appears in SCOPe 2.02
  
• d3remb_ appears in the current release, SCOPe 2.08