Class a: All alpha proteins [46456] (289 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins) intertwined homodimer of 3-helical subunits |
Protein automated matches [191058] (2 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries) |
Domain d3rema_: 3rem A: [184906] automated match to d2h9ca1 complexed with pyr, sal |
PDB Entry: 3rem (more details), 1.95 Å
SCOPe Domain Sequences for d3rema_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rema_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlper arwaeengldapfveglfaqiihwyiaeqikywrqtr
Timeline for d3rema_: