SCOPe 2.08: Domain d3reaa_: 3rea A:

Lineage for d3reaa_ (3rea A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
   alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.102.1: Regulatory factor Nef [55671] (2 families)

5. Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins)
   automatically mapped to Pfam PF00469

6. Protein automated matches [191288] (2 species)
   not a true protein

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (4 PDB entries)

8. Domain d3reaa_: 3rea A: [184904]
   Other proteins in same PDB: d3reab_, d3read_
   automated match to d2nefa_

Details for d3reaa_

PDB Entry: 3rea, 2 Å

PDB Description: hiv-1 nef protein in complex with engineered hck-sh3 domain

PDB Compounds: (A:) Protein Nef

SCOPe Domain Sequences for d3reaa_:

Sequence, based on SEQRES records:

>d3reaa_ d.102.1.1 (A:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
nadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeild
lwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepekveeanegennsllhpmslh
gmedaekevlvwrfdsklafhhmarelhpe

Sequence, based on observed residues (ATOM records):

>d3reaa_ d.102.1.1 (A:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
nadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeild
lwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepedaekevlvwrfdsklafhhm
arelhpe

Timeline for d3reaa_:

• d3reaa_ first appeared in SCOPe 2.01
  
• d3reaa_ appears in SCOPe 2.07