Lineage for d3reaa_ (3rea A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532501Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
    alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha
  4. 2532502Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) (S)
  5. 2532503Family d.102.1.1: Regulatory factor Nef [55672] (2 protein domains)
    automatically mapped to Pfam PF00469
  6. 2532512Protein automated matches [191288] (2 species)
    not a true protein
  7. 2532513Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (4 PDB entries)
  8. 2532514Domain d3reaa_: 3rea A: [184904]
    Other proteins in same PDB: d3reab_, d3read_
    automated match to d2nefa_

Details for d3reaa_

PDB Entry: 3rea (more details), 2 Å

PDB Description: hiv-1 nef protein in complex with engineered hck-sh3 domain
PDB Compounds: (A:) Protein Nef

SCOPe Domain Sequences for d3reaa_:

Sequence, based on SEQRES records: (download)

>d3reaa_ d.102.1.1 (A:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
nadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeild
lwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepekveeanegennsllhpmslh
gmedaekevlvwrfdsklafhhmarelhpe

Sequence, based on observed residues (ATOM records): (download)

>d3reaa_ d.102.1.1 (A:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
nadsawleaqeeeevgfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeild
lwiyhtqgyfpdwqnytpgpgirypltfgwcfklvpvepedaekevlvwrfdsklafhhm
arelhpe

SCOPe Domain Coordinates for d3reaa_:

Click to download the PDB-style file with coordinates for d3reaa_.
(The format of our PDB-style files is described here.)

Timeline for d3reaa_: