SCOPe 2.08: Domain d3re3c_: 3re3 C:

Lineage for d3re3c_ (3re3 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.0: automated matches [191525] (1 protein)
   not a true family

6. Protein automated matches [190884] (7 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [189938] (1 PDB entry)

8. Domain d3re3c_: 3re3 C: [184898]
   Other proteins in same PDB: d3re3a2, d3re3d2
   automated match to d1jn1a_
   complexed with cl, mpd, na, po4, pop

Details for d3re3c_

PDB Entry: 3re3, 2.65 Å

PDB Description: Crystal Structure of 2-C-Methyl-D-Erythritol 2,4-Cyclodiphosphate Synthase from Francisella tularensis

PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3re3c_:

Sequence, based on SEQRES records:

>d3re3c_ d.79.5.0 (C:) automated matches {Francisella tularensis [TaxId: 177416]}
msfrighgydvhkftsakqniiiggveiayhlgleahsdgdvlihalcdailgalglgdi
gkhfldtdnqfknidskfflaeikkmldkkqysisnidctiiaqapkmlphiekmracla
nileiqisqinikattterlgfigreegiathvvcllyr

Sequence, based on observed residues (ATOM records):

>d3re3c_ d.79.5.0 (C:) automated matches {Francisella tularensis [TaxId: 177416]}
msfrighgydvhkftsakqniiiggveiayhlgldgdvlihalcdailgalglgdigkhf
nidskfflaeikkmldkkqysisnidctiiaqapkmlphiekmraclanileiqisqini
kattterlgfigreegiathvvcllyr

Timeline for d3re3c_:

• d3re3c_ first appeared in SCOPe 2.01
  
• d3re3c_ appears in SCOPe 2.07