| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.5.0: automated matches [191525] (1 protein) not a true family |
| Protein automated matches [190884] (7 species) not a true protein |
| Species Francisella tularensis [TaxId:177416] [189938] (1 PDB entry) |
| Domain d3re3c_: 3re3 C: [184898] Other proteins in same PDB: d3re3a2, d3re3d2 automated match to d1jn1a_ complexed with cl, mpd, na, po4, pop |
PDB Entry: 3re3 (more details), 2.65 Å
SCOPe Domain Sequences for d3re3c_:
Sequence, based on SEQRES records: (download)
>d3re3c_ d.79.5.0 (C:) automated matches {Francisella tularensis [TaxId: 177416]}
msfrighgydvhkftsakqniiiggveiayhlgleahsdgdvlihalcdailgalglgdi
gkhfldtdnqfknidskfflaeikkmldkkqysisnidctiiaqapkmlphiekmracla
nileiqisqinikattterlgfigreegiathvvcllyr
>d3re3c_ d.79.5.0 (C:) automated matches {Francisella tularensis [TaxId: 177416]}
msfrighgydvhkftsakqniiiggveiayhlgldgdvlihalcdailgalglgdigkhf
nidskfflaeikkmldkkqysisnidctiiaqapkmlphiekmraclanileiqisqini
kattterlgfigreegiathvvcllyr
Timeline for d3re3c_: