Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) |
Family d.40.1.0: automated matches [191669] (1 protein) not a true family |
Protein automated matches [191272] (1 species) not a true protein |
Species Fagopyrum esculentum [TaxId:3617] [189855] (2 PDB entries) |
Domain d3rdzc_: 3rdz C: [184894] Other proteins in same PDB: d3rdza_, d3rdzb_ automated match to d1dwma_ complexed with ca |
PDB Entry: 3rdz (more details), 2.26 Å
SCOPe Domain Sequences for d3rdzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rdzc_ d.40.1.0 (C:) automated matches {Fagopyrum esculentum [TaxId: 3617]} qcsgkqewpelvgergskaakiienenedvraivlpegsavprdlrcdrvwvfvdergvv vdtpvvm
Timeline for d3rdzc_: