Lineage for d3rdzc_ (3rdz C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1410792Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 1410793Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 1410860Family d.40.1.0: automated matches [191669] (1 protein)
    not a true family
  6. 1410861Protein automated matches [191272] (1 species)
    not a true protein
  7. 1410862Species Fagopyrum esculentum [TaxId:3617] [189855] (2 PDB entries)
  8. 1410864Domain d3rdzc_: 3rdz C: [184894]
    Other proteins in same PDB: d3rdza_, d3rdzb_
    automated match to d1dwma_
    complexed with ca

Details for d3rdzc_

PDB Entry: 3rdz (more details), 2.26 Å

PDB Description: Crystal Structure of rBTI-trypsin complex at 2.26 angstrom resolution
PDB Compounds: (C:) BWI-1=PROTEASE inhibitor/trypsin inhibitor

SCOPe Domain Sequences for d3rdzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdzc_ d.40.1.0 (C:) automated matches {Fagopyrum esculentum [TaxId: 3617]}
qcsgkqewpelvgergskaakiienenedvraivlpegsavprdlrcdrvwvfvdergvv
vdtpvvm

SCOPe Domain Coordinates for d3rdzc_:

Click to download the PDB-style file with coordinates for d3rdzc_.
(The format of our PDB-style files is described here.)

Timeline for d3rdzc_: