SCOPe 2.07: Domain d3rdzb_: 3rdz B:

Lineage for d3rdzb_ (3rdz B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (494 PDB entries)
   Uniprot P00760

8. Domain d3rdzb_: 3rdz B: [184893]
   Other proteins in same PDB: d3rdzc_, d3rdzd_
   automated match to d1aq7a_
   complexed with ca

Details for d3rdzb_

PDB Entry: 3rdz, 2.26 Å

PDB Description: Crystal Structure of rBTI-trypsin complex at 2.26 angstrom resolution

PDB Compounds: (B:) cationic trypsin

SCOPe Domain Sequences for d3rdzb_:

Sequence, based on SEQRES records:

>d3rdzb_ b.47.1.2 (B:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records):

>d3rdzb_ b.47.1.2 (B:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslvasislptscasagtqclisgwgn
tkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvvc
sgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3rdzb_:

• d3rdzb_ first appeared in SCOPe 2.01
  
• d3rdzb_ appears in SCOPe 2.06
  
• d3rdzb_ appears in the current release, SCOPe 2.08