Lineage for d3rdzb_ (3rdz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796015Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
    Uniprot P00760
  8. 2796445Domain d3rdzb_: 3rdz B: [184893]
    Other proteins in same PDB: d3rdzc_, d3rdzd_
    automated match to d1aq7a_
    complexed with ca

Details for d3rdzb_

PDB Entry: 3rdz (more details), 2.26 Å

PDB Description: Crystal Structure of rBTI-trypsin complex at 2.26 angstrom resolution
PDB Compounds: (B:) cationic trypsin

SCOPe Domain Sequences for d3rdzb_:

Sequence, based on SEQRES records: (download)

>d3rdzb_ b.47.1.2 (B:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records): (download)

>d3rdzb_ b.47.1.2 (B:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslvasislptscasagtqclisgwgn
tkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpvvc
sgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d3rdzb_:

Click to download the PDB-style file with coordinates for d3rdzb_.
(The format of our PDB-style files is described here.)

Timeline for d3rdzb_: