![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) alpha+beta sandwich; loop across free side of beta-sheet |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) ![]() |
![]() | Family d.40.1.0: automated matches [191669] (1 protein) not a true family |
![]() | Protein automated matches [191272] (2 species) not a true protein |
![]() | Species Fagopyrum esculentum [TaxId:3617] [189855] (2 PDB entries) |
![]() | Domain d3rdya_: 3rdy A: [184891] automated match to d1dwma_ |
PDB Entry: 3rdy (more details), 1.84 Å
SCOPe Domain Sequences for d3rdya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rdya_ d.40.1.0 (A:) automated matches {Fagopyrum esculentum [TaxId: 3617]} qcsgkqewpelvgergskaakiienenedvraivlpegsavprdlrcdrvwvfvdergvv vdtpvvm
Timeline for d3rdya_: