Lineage for d3rdya_ (3rdy A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944763Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)
    alpha+beta sandwich; loop across free side of beta-sheet
  4. 2944764Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (2 families) (S)
  5. 2944844Family d.40.1.0: automated matches [191669] (1 protein)
    not a true family
  6. 2944845Protein automated matches [191272] (2 species)
    not a true protein
  7. 2944846Species Fagopyrum esculentum [TaxId:3617] [189855] (2 PDB entries)
  8. 2944849Domain d3rdya_: 3rdy A: [184891]
    automated match to d1dwma_

Details for d3rdya_

PDB Entry: 3rdy (more details), 1.84 Å

PDB Description: crystal structure of buckwheat trypsin inhibitor rbti at 1.84 angstrom resolution
PDB Compounds: (A:) BWI-1=PROTEASE inhibitor/trypsin inhibitor

SCOPe Domain Sequences for d3rdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdya_ d.40.1.0 (A:) automated matches {Fagopyrum esculentum [TaxId: 3617]}
qcsgkqewpelvgergskaakiienenedvraivlpegsavprdlrcdrvwvfvdergvv
vdtpvvm

SCOPe Domain Coordinates for d3rdya_:

Click to download the PDB-style file with coordinates for d3rdya_.
(The format of our PDB-style files is described here.)

Timeline for d3rdya_: