SCOPe 2.01: Domain d3rdra_: 3rdr A:

Lineage for d3rdra_ (3rdr A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.0: automated matches [191348] (1 protein)
   not a true family

6. Protein automated matches [190280] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189356] (2 PDB entries)

8. Domain d3rdra_: 3rdr A: [184890]
   automated match to d1yb0a1
   complexed with cl, zn

Details for d3rdra_

PDB Entry: 3rdr, 2.2 Å

PDB Description: Structure of the catalytic domain of XlyA

PDB Compounds: (A:) N-acetylmuramoyl-L-alanine amidase xlyA

SCOPe Domain Sequences for d3rdra_:

Sequence; same for both SEQRES and ATOM records:

>d3rdra_ d.118.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
vniiqdfipvgannrpgyamtplyitvhntantavgadaaaharylknpdtttswhftvd
dteiyqhlplnengwhagdgngsgnrasigieicenadgdfakatanaqwliktlmaehn
islanvvphkywsgkecprklldtwdsfkagig

Timeline for d3rdra_:

• d3rdra_ is new in SCOPe 2.01-stable
  
• d3rdra_ appears in SCOPe 2.02
  
• d3rdra_ appears in the current release, SCOPe 2.08