SCOP 1.69: Domain d1hc2_1: 1hc2 5-135

Lineage for d1hc2_1 (1hc2 5-135)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
   6 helices; bundle; one central helix is surrounded by 5 others

4. Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family)

5. Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)

6. Protein Hemocyanin, N-terminal domain [48052] (2 species)
   Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich

7. Species Spiny lobster (Panulirus interruptus) [TaxId:6735] [48054] (7 PDB entries)

8. Domain d1hc2_1: 1hc2 5-135 [18489]
   Other proteins in same PDB: d1hc2_2, d1hc2_3

Details for d1hc2_1

PDB Entry: 1hc2, 3.2 Å

PDB Description: crystal structure of hexameric haemocyanin from panulirus interruptus refined at 3.2 angstroms resolution

SCOP Domain Sequences for d1hc2_1:

Sequence; same for both SEQRES and ATOM records:

>d1hc2_1 a.85.1.1 (5-135) Hemocyanin, N-terminal domain {Spiny lobster (Panulirus interruptus)}
tgnaqkqqdinhlldkiyeptkypdlkdiaenfnplgdtsiyndhgaavetlmkelndhr
lleqrhwyslfntrqrkealmlfavlnqckewycfrsnaayfrermnegefvyalyvsvi
hsklgdgivlp

Timeline for d1hc2_1:

• d1hc2_1 first appeared (with stable ids) in SCOP 1.55
  
• d1hc2_1 appears in SCOP 1.67
  
• d1hc2_1 appears in SCOP 1.71
  
• d1hc2_1 last appears in SCOP 1.73, called d1hc2a1