| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
| Protein automated matches [190233] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
| Domain d3rd2a1: 3rd2 A:345-419 [184885] Other proteins in same PDB: d3rd2a2 automated match to d1u4aa1 |
PDB Entry: 3rd2 (more details), 1.6 Å
SCOPe Domain Sequences for d3rd2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rd2a1 d.15.1.0 (A:345-419) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqqlqlrvqgkekhqtlevslsrdsplktlmshyeeamglsgrklsfffdgtklsgrelp
adlgmesgdlievwg
Timeline for d3rd2a1: