Lineage for d1ll1a1 (1ll1 A:1-109)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772988Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily)
    6 helices; bundle; one central helix is surrounded by 5 others
  4. 772989Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) (S)
  5. 772990Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein)
  6. 772991Protein Hemocyanin, N-terminal domain [48052] (2 species)
    Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich
  7. 772992Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48053] (4 PDB entries)
  8. 772994Domain d1ll1a1: 1ll1 A:1-109 [18488]
    Other proteins in same PDB: d1ll1a2, d1ll1a3
    complexed with cl, cu

Details for d1ll1a1

PDB Entry: 1ll1 (more details), 2.55 Å

PDB Description: hydroxo bridge met form hemocyanin from limulus
PDB Compounds: (A:) metcyanin II

SCOP Domain Sequences for d1ll1a1:

Sequence, based on SEQRES records: (download)

>d1ll1a1 a.85.1.1 (A:1-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tlhdkqirvchlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhl
yevfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvp

Sequence, based on observed residues (ATOM records): (download)

>d1ll1a1 a.85.1.1 (A:1-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tlhdkqirvchlfeqlssatvirlknvgklqpgaifscfhpdhleearhlyevfweagdf
ndfieiakeartfvneglfafaaevavlhrddckglyvp

SCOP Domain Coordinates for d1ll1a1:

Click to download the PDB-style file with coordinates for d1ll1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ll1a1: