Class a: All alpha proteins [46456] (202 folds) |
Fold a.85: Hemocyanin, N-terminal domain [48049] (1 superfamily) 6 helices; bundle; one central helix is surrounded by 5 others |
Superfamily a.85.1: Hemocyanin, N-terminal domain [48050] (1 family) |
Family a.85.1.1: Hemocyanin, N-terminal domain [48051] (1 protein) |
Protein Hemocyanin, N-terminal domain [48052] (2 species) Middle domain is all-alpha; C-terminal domain is immunoglobulin-like sandwich |
Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48053] (4 PDB entries) |
Domain d1ll1_1: 1ll1 1-109 [18488] Other proteins in same PDB: d1ll1_2, d1ll1_3 complexed with cl, cu |
PDB Entry: 1ll1 (more details), 2.55 Å
SCOP Domain Sequences for d1ll1_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ll1_1 a.85.1.1 (1-109) Hemocyanin, N-terminal domain {Horseshoe crab (Limulus polyphemus)} tlhdkqirvchlfeqlssatvirlknvgklqpgaifscfhpdhleearhlyevfweagdf ndfieiakeartfvneglfafaaevavlhrddckglyvp
Timeline for d1ll1_1: