Lineage for d3rbbc_ (3rbb C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208490Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
    alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha
  4. 2208491Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) (S)
  5. 2208492Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins)
    automatically mapped to Pfam PF00469
  6. 2208501Protein automated matches [191288] (2 species)
    not a true protein
  7. 2208502Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (4 PDB entries)
  8. 2208509Domain d3rbbc_: 3rbb C: [184876]
    Other proteins in same PDB: d3rbbb_, d3rbbd_
    automated match to d2nefa_
    complexed with edo

Details for d3rbbc_

PDB Entry: 3rbb (more details), 2.35 Å

PDB Description: HIV-1 NEF protein in complex with engineered HCK SH3 domain
PDB Compounds: (C:) Protein Nef

SCOPe Domain Sequences for d3rbbc_:

Sequence, based on SEQRES records: (download)

>d3rbbc_ d.102.1.1 (C:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
evgfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdw
qnytpgpgirypltfgwcfklvpvepekveeanegennsllhpmslhgmedaekevlvwr
fdsklafhhmarelhpeyyk

Sequence, based on observed residues (ATOM records): (download)

>d3rbbc_ d.102.1.1 (C:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
evgfpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdw
qnytpgpgirypltfgwcfklvpvepeksllhpmaekevlvwrfdsklafhhmarelhpe
yyk

SCOPe Domain Coordinates for d3rbbc_:

Click to download the PDB-style file with coordinates for d3rbbc_.
(The format of our PDB-style files is described here.)

Timeline for d3rbbc_: