Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.102: Regulatory factor Nef [55670] (1 superfamily) alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) |
Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins) |
Protein automated matches [191288] (1 species) not a true protein |
Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (2 PDB entries) |
Domain d3rbba_: 3rbb A: [184875] automated match to d2nefa_ complexed with edo |
PDB Entry: 3rbb (more details), 2.35 Å
SCOPe Domain Sequences for d3rbba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rbba_ d.102.1.1 (A:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]} fpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqny tpgpgirypltfgwcfklvpvepekveeanegennsllhpmslhgmedaekevlvwrfds klafhhmarelhpeyyk
Timeline for d3rbba_: