SCOPe 2.01: Domain d3rbba_: 3rbb A:

Lineage for d3rbba_ (3rbb A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
   alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.102.1: Regulatory factor Nef [55671] (2 families)

5. Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins)

6. Protein automated matches [191288] (1 species)
   not a true protein

7. Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [189936] (2 PDB entries)

8. Domain d3rbba_: 3rbb A: [184875]
   automated match to d2nefa_
   complexed with edo

Details for d3rbba_

PDB Entry: 3rbb, 2.35 Å

PDB Description: HIV-1 NEF protein in complex with engineered HCK SH3 domain

PDB Compounds: (A:) Protein Nef

SCOPe Domain Sequences for d3rbba_:

Sequence; same for both SEQRES and ATOM records:

>d3rbba_ d.102.1.1 (A:) automated matches {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]}
fpvrpqvplrpmtykaaldishflkekgglegliwsqrrqeildlwiyhtqgyfpdwqny
tpgpgirypltfgwcfklvpvepekveeanegennsllhpmslhgmedaekevlvwrfds
klafhhmarelhpeyyk

Timeline for d3rbba_:

• d3rbba_ is new in SCOPe 2.01-stable
  
• d3rbba_ appears in SCOPe 2.02
  
• d3rbba_ appears in the current release, SCOPe 2.08