SCOPe 2.06: Domain d3r9va_: 3r9v A:

Lineage for d3r9va_ (3r9v A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.250: IpaD-like [140692] (1 superfamily)
   6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest

4. Superfamily a.250.1: IpaD-like [140693] (2 families)

5. Family a.250.1.1: IpaD-like [140694] (3 proteins)
   Pfam PF06511

6. Protein automated matches [191266] (1 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [189835] (7 PDB entries)

8. Domain d3r9va_: 3r9v A: [184866]
   automated match to d2j0oa1
   complexed with dxc, gol

Details for d3r9va_

PDB Entry: 3r9v, 1.9 Å

PDB Description: Cocrystal Structure of Proteolytically Truncated Form of IpaD from Shigella flexneri Bound to Deoxycholate

PDB Compounds: (A:) invasin ipad

SCOPe Domain Sequences for d3r9va_:

Sequence; same for both SEQRES and ATOM records:

>d3r9va_ a.250.1.1 (A:) automated matches {Shigella flexneri [TaxId: 623]}
eldgdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispg
gndgnsvklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqkn
ggyvvsinmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqky
snansifdnlvkvlssti

Timeline for d3r9va_:

• d3r9va_ first appeared in SCOPe 2.01
  
• d3r9va_ appears in SCOPe 2.05
  
• d3r9va_ appears in SCOPe 2.07
  
• d3r9va_ appears in the current release, SCOPe 2.08