![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.250: IpaD-like [140692] (1 superfamily) 6 helices; bundle, up-and-down; can be divided into two four-helical bundles sharing two helices (3 and 6), which are twice longer than the rest |
![]() | Superfamily a.250.1: IpaD-like [140693] (2 families) ![]() |
![]() | Family a.250.1.1: IpaD-like [140694] (3 proteins) Pfam PF06511 |
![]() | Protein automated matches [191266] (1 species) not a true protein |
![]() | Species Shigella flexneri [TaxId:623] [189835] (7 PDB entries) |
![]() | Domain d3r9va_: 3r9v A: [184866] automated match to d2j0oa1 complexed with dxc, gol |
PDB Entry: 3r9v (more details), 1.9 Å
SCOPe Domain Sequences for d3r9va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r9va_ a.250.1.1 (A:) automated matches {Shigella flexneri [TaxId: 623]} eldgdqmishrelwakiansindineqylkvyehavssytqmyqdfsavlsslagwispg gndgnsvklqvnslkkaleelkekykdkplypanntvsqeqankwltelggtigkvsqkn ggyvvsinmtpidnmlksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqky snansifdnlvkvlssti
Timeline for d3r9va_: