Lineage for d3r9tc_ (3r9t C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100309Species Mycobacterium avium [TaxId:1770] [189738] (3 PDB entries)
  8. 2100312Domain d3r9tc_: 3r9t C: [184865]
    automated match to d1duba_
    complexed with bez

Details for d3r9tc_

PDB Entry: 3r9t (more details), 1.75 Å

PDB Description: structure of echa1_1 from mycobacterium paratuberculosis atcc baa-968 / k-10
PDB Compounds: (C:) EchA1_1

SCOPe Domain Sequences for d3r9tc_:

Sequence, based on SEQRES records: (download)

>d3r9tc_ c.14.1.0 (C:) automated matches {Mycobacterium avium [TaxId: 1770]}
dapgalaerrgnvmvitinrpearnainaavsigvgdaleeaqhdpevravvltgagdks
fcagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtelalasdlv
vaderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardwglinev
veagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmremrallks
edakegprafaekrepvwqar

Sequence, based on observed residues (ATOM records): (download)

>d3r9tc_ c.14.1.0 (C:) automated matches {Mycobacterium avium [TaxId: 1770]}
dapgalaerrgnvmvitinrpearnainaavsigvgdaleeaqhdpevravvltgagdks
fcagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtelalasdlv
vaderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardwglinev
veagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmremrallks
edakegpraekrepvwqar

SCOPe Domain Coordinates for d3r9tc_:

Click to download the PDB-style file with coordinates for d3r9tc_.
(The format of our PDB-style files is described here.)

Timeline for d3r9tc_: