Lineage for d3r9sb_ (3r9s B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100325Species Mycobacterium avium [TaxId:243243] [189433] (5 PDB entries)
  8. 2100337Domain d3r9sb_: 3r9s B: [184861]
    automated match to d1duba_
    complexed with bez, edo

Details for d3r9sb_

PDB Entry: 3r9s (more details), 2.2 Å

PDB Description: structure of a carnitinyl-coa dehydratase from mycobacterium avium 104
PDB Compounds: (B:) Carnitinyl-CoA dehydratase

SCOPe Domain Sequences for d3r9sb_:

Sequence, based on SEQRES records: (download)

>d3r9sb_ c.14.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 243243]}
apgalaerrgnvmvitinrpearnavnaavsigvgdaleeaqhdpevravvltgagdksf
cagadlkaiarrenlyhpdhpewgfagyvrhfidkptiaavngtalgggtelalasdlvv
aderaqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardwglinevv
eagsvldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmremrallkse
dakegprafaekrepvwqar

Sequence, based on observed residues (ATOM records): (download)

>d3r9sb_ c.14.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 243243]}
apgalaerrgnvmvitinrpearnavnaavsigvgdaleeaqhdpevravvltgagdksf
cagadlkaenlyhpdhpewgfagyvrhfidkptiaavngtalgggtelalasdlvvader
aqfglpevkrgliaaaggvfriaeqlprkvamrllltgeplsaaaardwglinevveags
vldaalalasaitvnaplsvqaskriaygvddgvvvgdepgwdrtmremrallksedake
gprafaekrepvwqar

SCOPe Domain Coordinates for d3r9sb_:

Click to download the PDB-style file with coordinates for d3r9sb_.
(The format of our PDB-style files is described here.)

Timeline for d3r9sb_: